PDB entry 2q8z

View 2q8z on RCSB PDB site
Description: Crystal structure of Plasmodium falciparum orotidine 5'-phosphate decarboxylase complexed with 6-amino-UMP
Class: lyase
Keywords: Plasmodium falciparum, orotidine 5'-phosphate decarboxylase, 6-amino-UMP, LYASE
Deposited on 2007-06-12, released 2008-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine-monophosphate-decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF10_0225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IJH3 (19-341)
      • expression tag (12-18)
    Domains in SCOPe 2.07: d2q8za2, d2q8za3
  • Chain 'B':
    Compound: orotidine-monophosphate-decarboxylase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF10_0225
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q8zb_
  • Heterogens: SO4, NUP, 7PE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q8zA (A:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q8zA (A:)
    glvprgsmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyi
    nnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygs
    vgidvlknvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnml
    kdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqn
    nefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinig
    raitknpypqkaaqmyydqinailkqnmes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q8zB (B:)
    mgsshhhhhhssglvprgsmgfkvklekrrnaintclcigldpdekdienfmknekenny
    nnikknlkekyinnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltf
    kmnfafyipygsvgidvlknvfdylyelniptildmkindigntvknyrkfifeylksds
    ctvniymgtnmlkdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqea
    lnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngy
    hksyekilinigraitknpypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q8zB (B:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnm