PDB entry 2q8l

View 2q8l on RCSB PDB site
Description: Crystal structure of orotidine 5'-phosphate decarboxylase from Plasmodium falciparum
Class: lyase
Keywords: Plasmodium falciparum, orotidine-5'-monophosphate decarboxylase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-06-11, released 2007-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-19, with a file datestamp of 2007-06-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine-monophosphate-decarboxylase
    Species: Plasmodium falciparum 3D7
    Gene: PF10_0225
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2q8la1
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q8lA (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
    vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
    ypqkaaqmyydqinailkqnmes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q8lA (A:)
    mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
    dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
    nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
    eknkyysafvlvkttnpdsaifqkqayvimaqealnmssylnleqnnefigfvvgansyd
    emnyirtyfpncyilspgigngdlhktltngyhksyekilinigraitknpypqkaaqmy
    ydqinailkqnmes