PDB entry 2q8a

View 2q8a on RCSB PDB site
Description: Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
Class: immune system
Keywords: antigen-antibody complex, Immune System
Deposited on 2007-06-10, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apical membrane antigen 1
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: AMA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 1F9 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q8A (0-End)
    Domains in SCOPe 2.07: d2q8ah1
  • Chain 'L':
    Compound: 1F9 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q8A (0-213)
    Domains in SCOPe 2.07: d2q8al1, d2q8al2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2q8aH (H:)
    evqlqqsgaellkpgasvklscivsgfkikdtsmhwvkqrpeqglewigridpandnsey
    dpkfqgkatitadtssntaylqlssltsedtavyyctlshfwgqgttltvssakttppsv
    yplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssv
    tvpsstwpsqtvtcsvahpassttvdkkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q8aH (H:)
    evqlqqsgaellkpgasvklscivsgfkikdtsmhwvkqrpeqglewigridpandnsey
    dpkfqgkatitadtssntaylqlssltsedtavyyctlshfwgqgttltvssakttppsv
    yplapgcgssvtlgclvkgyfpesvtvtwnssvhtfpallqsglytmsssvtvpsstwps
    qtvtcsvahpassttvdkk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q8aL (L:)
    sivmtqtpkflpvsagdrvtiickasqsvsndvvwyqqkpgqspklliyyasirytgvpd
    rftgsgygtdftftistvqvedlavyfcqqgfssprtfgggtkleinradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec