PDB entry 2q86

View 2q86 on RCSB PDB site
Description: Structure of the mouse invariant NKT cell receptor Valpha14
Class: immune system
Keywords: iNKT cells, TCR, glycolipid recognition, innate immunity, IMMUNE SYSTEM
Deposited on 2007-06-08, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Valpha14 TCR
    Species: Mus musculus [TaxId:10090]
    Gene: Valpha14
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q86 (0-End)
    Domains in SCOPe 2.07: d2q86a1, d2q86a2
  • Chain 'B':
    Compound: Vbeta8.2
    Species: Mus musculus [TaxId:10090]
    Gene: Vbeta8.2
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q86
    Domains in SCOPe 2.07: d2q86b1, d2q86b2
  • Chain 'C':
    Compound: Valpha14 TCR
    Species: Mus musculus [TaxId:10090]
    Gene: Valpha14
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q86 (0-End)
    Domains in SCOPe 2.07: d2q86c1, d2q86c2
  • Chain 'D':
    Compound: Vbeta8.2
    Species: Mus musculus [TaxId:10090]
    Gene: Vbeta8.2
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q86
    Domains in SCOPe 2.07: d2q86d1, d2q86d2
  • Heterogens: NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q86A (A:)
    ktqveqspqslvvrqgencvlqcnysvtpdnhlrwykqdtgkglvlltvlvdqkdktsng
    rysatldkdakhstlhitatllddtatyfcvvgdrgsalfgsgtqlivipyiqnpepavy
    qlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksngaiawsnqts
    ftcqdifketnatypssdvpcdatlteksfetdmnlnfqnlssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q86A (A:)
    ktqveqspqslvvrqgencvlqcnysvtpdnhlrwykqdtgkglvlltvlvdqkdktsng
    rysatldkdakhstlhitatllddtatyfcvvgdrgsalfgsgtqlivipyiqnpepavy
    qlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmksksngaiawsnqtsftc
    qdifketna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q86B (B:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradcgit
    sasyhqssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q86B (B:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppkvs
    lfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysycl
    ssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q86C (C:)
    ktqveqspqslvvrqgencvlqcnysvtpdnhlrwykqdtgkglvlltvlvdqkdktsng
    rysatldkdakhstlhitatllddtatyfcvvgdrgsalfgsgtqlivipyiqnpepavy
    qlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksngaiawsnqts
    ftcqdifketnatypssdvpcdatlteksfetdmnlnfqnlssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q86C (C:)
    ktqveqspqslvvrqgencvlqcnysvtpdnhlrwykqdtgkglvlltvlvdqkdktsng
    rysatldkdakhstlhitatllddtatyfcvvgdrgsalfgsgtqlivipyiqnpepavy
    qlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmksksngaiawsnqtsftc
    qdifketnat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q86D (D:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradcgit
    sasyhqssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q86D (D:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppkvs
    lfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnysycl
    ssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra