PDB entry 2q80

View 2q80 on RCSB PDB site
Description: Crystal structure of human geranylgeranyl pyrophosphate synthase bound to GGPP
Class: transferase
Keywords: isoprenoid pathway, isopentenyl transferase, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2007-06-08, released 2007-06-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q80a1
  • Chain 'B':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q80b_
  • Chain 'C':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q80c_
  • Chain 'D':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q80d_
  • Chain 'E':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q80e_
  • Chain 'F':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q80f_
  • Heterogens: MG, GRG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q80A (A:)
    smektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhna
    slliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrql
    lelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllnt
    lglffqirddyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqnilrqrte
    nidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfkeen
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q80A (A:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irddyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyl
    edvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q80B (B:)
    smektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhna
    slliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrql
    lelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllnt
    lglffqirddyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqnilrqrte
    nidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfkeen
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q80B (B:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irddyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyl
    edvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q80C (C:)
    smektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhna
    slliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrql
    lelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllnt
    lglffqirddyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqnilrqrte
    nidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfkeen
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q80C (C:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irddyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyl
    edvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q80D (D:)
    smektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhna
    slliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrql
    lelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllnt
    lglffqirddyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqnilrqrte
    nidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfkeen
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q80D (D:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irddyanlhsnksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhy
    ledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2q80E (E:)
    smektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhna
    slliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrql
    lelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllnt
    lglffqirddyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqnilrqrte
    nidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfkeen
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q80E (E:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irddyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyl
    edvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2q80F (F:)
    smektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhna
    slliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrql
    lelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllnt
    lglffqirddyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqnilrqrte
    nidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfkeen
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q80F (F:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhpdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irddyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyl
    edvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmf