PDB entry 2q66

View 2q66 on RCSB PDB site
Description: Structure of Yeast Poly(A) Polymerase with ATP and oligo(A)
Class: Transferase/RNA
Keywords: protein RNA complex ATP polymerase complex, Transferase/RNA COMPLEX
Deposited on 2007-06-04, released 2007-08-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: poly(a) polymerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29468 (0-524)
      • engineered (149)
    Domains in SCOPe 2.04: d2q66a1, d2q66a2, d2q66a3
  • Chain 'X':
    Compound: 5'-r(p*ap*ap*ap*ap*a)-3'
    Species: synthetic, synthetic
  • Heterogens: MG, ATP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q66A (A:)
    kvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfvy
    evskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsll
    rerkeldeiapvpdafvpiikikfsgisialicarldqpqvplsltlsdknllrnldekd
    lralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlvaric
    qlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvit
    paypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfylei
    taytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddyemi
    qdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfnienkkekvdihip
    ctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q66A (A:)
    kvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfvy
    evskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsll
    rerkeldeiapvpdafvpiikikfsgisialicarldqpqvplsltlsdknllrnldekd
    lralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlvaric
    qlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvit
    paypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfylei
    taytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddyemi
    qdkygshktetalnalklvtdeneeesikdapkaylstmyigldfnikvdihipctefvn
    lcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrp
    

  • Chain 'X':
    No sequence available.