PDB entry 2q5p

View 2q5p on RCSB PDB site
Description: Crystal Structure of PPARgamma bound to partial agonist MRL24
Class: Ligand binding protein
Keywords: Protein-ligand complex, Ligand binding protein
Deposited on 2007-06-01, released 2007-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q5pa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2q5pb_
  • Heterogens: 241, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q5pA (A:)
    snpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
    fkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvh
    eiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsd
    laifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlr
    qivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5pA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkevair
    ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
    isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
    lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
    tdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q5pB (B:)
    snpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
    fkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvh
    eiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsd
    laifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlr
    qivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5pB (B:)
    esadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgefkhitvairif
    qgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlis
    egqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpglln
    vkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvilhpllq
    eiykd