PDB entry 2q59

View 2q59 on RCSB PDB site
Description: Crystal Structure of PPARgamma LBD bound to full agonist MRL20
Class: Ligand binding protein
Keywords: Protein-ligand complex, Ligand binding protein
Deposited on 2007-05-31, released 2007-10-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231
      • modified residue (81)
    Domains in SCOPe 2.02: d2q59a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2q59b_
  • Heterogens: 240, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q59A (A:)
    snpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
    fkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvh
    eiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsd
    laifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlr
    qivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q59A (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkevair
    ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
    isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
    lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
    tdmslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q59B (B:)
    snpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
    fkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvh
    eiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsd
    laifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlr
    qivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q59B (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    ikevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlasl
    mnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviil
    sgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqll
    qvihpllqeiykd