PDB entry 2q58

View 2q58 on RCSB PDB site
Description: Cryptosporidium parvum putative polyprenyl pyrophosphate synthase (cgd4_2550) in complex with zoledronate
Class: transferase
Keywords: farnesyl diphosphate synthase, structural genomics, structural genomics consortium, sgc, transferase
Deposited on 2007-05-31, released 2007-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: CGD4_2550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q58a_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: CGD4_2550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q58b_
  • Heterogens: MG, ZOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q58A (A:)
    mgsshhhhhhssgrenlyfqgeydytdfinyydkfkvivynvlkklplndeirkpvieyy
    lncidynvkkgkhirgkilvlisslssaysnikrdsiyllgwvveaiqaliliaddimds
    gkfrrgapcwyivhgqsnaindifflkmlslslifelssvfgndivmkiqkiynesifft
    vlgqhldlsyfdlskadkiseryfsmvemktsrytfympvffgltlseiqvssaqlnlie
    ailyklgefyqvhndvsdylfndsnaddicrfkltwplqksfeiadeemklkisenygkn
    sslvkdcynllkinehyleyqrnaldyliklvkditddslqkvfihlihqiselitnsrs
    nadsnnsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q58A (A:)
    ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli
    sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind
    ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser
    yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn
    dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr
    naldyliklvkditddslqkvfihlihqiselitn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q58B (B:)
    mgsshhhhhhssgrenlyfqgeydytdfinyydkfkvivynvlkklplndeirkpvieyy
    lncidynvkkgkhirgkilvlisslssaysnikrdsiyllgwvveaiqaliliaddimds
    gkfrrgapcwyivhgqsnaindifflkmlslslifelssvfgndivmkiqkiynesifft
    vlgqhldlsyfdlskadkiseryfsmvemktsrytfympvffgltlseiqvssaqlnlie
    ailyklgefyqvhndvsdylfndsnaddicrfkltwplqksfeiadeemklkisenygkn
    sslvkdcynllkinehyleyqrnaldyliklvkditddslqkvfihlihqiselitnsrs
    nadsnnsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q58B (B:)
    ydytdfinyydkfkvivynvlkklpvieyylncidynvkkgkhirgkilvlisslaysni
    krdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaindifflkmlsls
    lifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiseryfsmvemkts
    rytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfndsnaddicrf
    kltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqrnaldyliklv
    kditddslqkvfihlihqiselitnsrsn