PDB entry 2q4s

View 2q4s on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of cysteine dioxygenase type I from Mus musculus Mm.241056
Class: oxidoreductase
Keywords: Ensemble Refinement, Refinement Methodology Development, Mm.241056, pfam05995.2 CDO_I, BC013638, CUPIN FAMILY, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, OXIDOREDUCTASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-02, with a file datestamp of 2007-09-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.159
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine dioxygenase type 1
    Species: MUS MUSCULUS
    Gene: Cdo1, Mm.241056
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60334
      • modified residue (72)
      • modified residue (116)
      • modified residue (178)
    Domains in SCOP 1.75: d2q4sa1
  • Heterogens: NI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4sA (A:)
    sertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytr
    nlvdqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikk
    sertlrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmt
    fhskfgirtpfttsgslenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4sA (A:)
    ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
    qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
    lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
    fgirtp