PDB entry 2q49

View 2q49 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At2g19940
Class: oxidoreductase
Keywords: Ensemble Refinement, Refinement Methodology Development, AT2G19940, CATH 3.40.50 FOLD, SEMIALDEHYDE DEHYDROGENASE FAMILY, TETRAMER, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, OXIDOREDUCTASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.152
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g19940, F6F22.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q49a1, d2q49a2
  • Chain 'B':
    Compound: Probable N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g19940, F6F22.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q49b1, d2q49b2
  • Chain 'C':
    Compound: Probable N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g19940, F6F22.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q49c1, d2q49c2
  • Chain 'D':
    Compound: Probable N-acetyl-gamma-glutamyl-phosphate reductase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g19940, F6F22.3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q49d1, d2q49d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q49A (A:)
    msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesv
    fphlraqklptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrni
    aeyeewygqphkavelqkevvyglteilredikkarlvanpgcypttiqlplvpllkanl
    ikheniiidaksgvsgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskv
    tvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnv
    rgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q49A (A:)
    kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
    vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
    elqkevvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgv
    sgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirg
    mqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnvrgsnychmsvfpdr
    ipgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q49B (B:)
    msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesv
    fphlraqklptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrni
    aeyeewygqphkavelqkevvyglteilredikkarlvanpgcypttiqlplvpllkanl
    ikheniiidaksgvsgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskv
    tvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnv
    rgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q49B (B:)
    kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
    vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
    elqkevvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgv
    sgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirg
    mqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnvrgsnychmsvfpdr
    ipgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q49C (C:)
    msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesv
    fphlraqklptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrni
    aeyeewygqphkavelqkevvyglteilredikkarlvanpgcypttiqlplvpllkanl
    ikheniiidaksgvsgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskv
    tvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnv
    rgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q49C (C:)
    kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
    vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
    elqkevvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgv
    sgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirg
    mqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnvrgsnychmsvfpdr
    ipgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q49D (D:)
    msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesv
    fphlraqklptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrni
    aeyeewygqphkavelqkevvyglteilredikkarlvanpgcypttiqlplvpllkanl
    ikheniiidaksgvsgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskv
    tvsftphlmpmirgmqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnv
    rgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q49D (D:)
    kdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqklptlvs
    vkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkav
    elqkevvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgv
    sgagrgakeanlyseiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirg
    mqstiyvemapgvrtedlhqqlktsyedeefvkvldegvvprthnvrgsnychmsvfpdr
    ipgraiiisvidnlvkgasgqalqnlnimlgypettgllhqplfp