PDB entry 2q3z

View 2q3z on RCSB PDB site
Description: Transglutaminase 2 undergoes large conformational change upon activation
Class: transferase
Keywords: Transglutaminase 2, tissue transglutaminase, TG2, TRANSFERASE
Deposited on 2007-05-30, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transglutaminase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21980 (0-End)
      • conflict (50)
      • conflict (185)
      • conflict (223)
      • conflict (532)
      • conflict (654)
    Domains in SCOPe 2.07: d2q3za1, d2q3za2, d2q3za3, d2q3za4
  • Chain 'X':
    Compound: polypeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q3Z
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q3zA (A:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfqdgildiclilldvnpkflknagrdcsrrsspvyvgrvgsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdqnsnllieyfrnefgeiqgdksemiwnfhcwveswmtrpdlqpgyegwqaldpt
    pqeksegtyccgpvpvraikegdlstkydapfvfaevnadvvdwiqqddgsvhksinrsl
    ivglkistksvgrderedithtykypegsseereaftranhlnklaekeetgmamrirvg
    qsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtkyllnltlepfsek
    svplcilyekyrdcltesnlikvrallvepvinsyllaerdlylenpeikirilgepkqk
    rklvaevslqnplpvalegctftvegaglteeqktveipdpveageevkvrmdlvplhmg
    lhklvvnfesdklkavkgfrnviigpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3zA (A:)
    maeelvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfs
    vvtgpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsle
    astgyqgssfvlghfillfnawcpadavyldseeerqeyvltqqgfiyqgsakfiknipw
    nfgqfqdgildiclilldvnpkflknagrdcsrrsspvyvgrvgsgmvncnddqgvllgr
    wdnnygdgvspmswigsvdilrrwknhgcqrvkygqcwvfaavactvlrclgiptrvvtn
    ynsahdsnllieyfrnsemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtycc
    gpvpvraikegdlstkydapfvfaevnadvvdwiqksinrslivglkistksvgrdered
    ithtykypegsseereaftranhgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrll
    lcartvsyngilgpecgtkyllnltlepfseksvplcilyekyrdcltesnlikvrallv
    epvinsyllaerdlylenpeikirilgepkqkrklvaevslqnplpvalegctftvegag
    lteeqktveipdpveageevkvrmdlvplhmglhklvvnfesdklkavkgfrnvi
    

  • Chain 'X':
    No sequence available.