PDB entry 2q3u

View 2q3u on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g08170, agmatine iminohydrolase
Class: hydrolase
Keywords: Ensemble Refinement, Refinement Methodology Development, At5g08170, POLYAMINE BIOSYNTHESIS, AGMATINE IMINOHYDROLASE, AIH, AGMATINE DEIMINASE, N-CARBAMOYLPUTRESCINE, PUTRESCINE, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.135
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agmatine deiminase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AIH, At5g08170, T22D6.110
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GWW7
      • modified residue (14)
      • variant (48)
      • modified residue (84)
      • modified residue (86)
      • modified residue (158)
      • modified residue (189)
      • modified residue (227)
      • modified residue (283)
    Domains in SCOPe 2.02: d2q3ua_
  • Chain 'B':
    Compound: agmatine deiminase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AIH, At5g08170, T22D6.110
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GWW7
      • modified residue (14)
      • variant (48)
      • modified residue (84)
      • modified residue (86)
      • modified residue (158)
      • modified residue (189)
      • modified residue (227)
      • modified residue (283)
    Domains in SCOPe 2.02: d2q3ub_
  • Heterogens: MG, EDO, MPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q3uA (A:)
    meesrespaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepv
    tvcaspaqwenarkqlpedirvvemsmndswfrdsgptfivrkrpvklsslnrniagidw
    nfnawggandgcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteec
    llnknrnphmskeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvlls
    wtddetdpqyersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaip
    rlagtrlaasyvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivla
    ggnihcitqqqpaeptsvaengh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3uA (A:)
    respaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvtvca
    spaqwenarkqlpedirvvemsmndswfrdsgptfivrkrnrniagidwnfnawggandg
    cyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknrnphms
    keqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtddetdpqye
    rsvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlagtrlaasy
    vnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggnihcitqqq
    paept
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q3uB (B:)
    meesrespaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepv
    tvcaspaqwenarkqlpedirvvemsmndswfrdsgptfivrkrpvklsslnrniagidw
    nfnawggandgcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteec
    llnknrnphmskeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvlls
    wtddetdpqyersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaip
    rlagtrlaasyvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivla
    ggnihcitqqqpaeptsvaengh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3uB (B:)
    spaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvtvcasp
    aqwenarkqlpedirvvemsmndswfrdsgptfivrkrnrniagidwnfnawggandgcy
    ndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknrnphmske
    qieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtddetdpqyers
    vealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlagtrlaasyvn
    fyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggnihcitqqqpa
    ept