PDB entry 2q2j

View 2q2j on RCSB PDB site
Description: Crystal structure of PrTX-I, a PLA2 homolog from Bothrops pirajai
Class: toxin
Keywords: myotoxin, PLA2 like, Lys49-PLA2, phospholipase A2
Deposited on 2007-05-28, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.214
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog 1
    Species: BOTHROPS PIRAJAI [TaxId:113192]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58399 (0-120)
      • see remark 999 (105)
    Domains in SCOPe 2.08: d2q2ja_
  • Chain 'B':
    Compound: Phospholipase A2 homolog 1
    Species: BOTHROPS PIRAJAI [TaxId:113192]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58399 (0-120)
      • see remark 999 (105)
    Domains in SCOPe 2.08: d2q2jb_
  • Heterogens: SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2q2jA (A:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadd
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2q2jB (B:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadd
c