PDB entry 2q20
View 2q20 on RCSB PDB site
Description: Structure of the germline Vk1 O18/O8 light chain variable domain homodimer
Class: protein fibril
Keywords: Vk1, germline, AL, light chain amyloidosis, amyloid, immunoglobulin, light chain, light chain variable domain, PROTEIN FIBRIL
Deposited on
2007-05-25, released
2008-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.12
AEROSPACI score: 0.8
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Vk1 O18/O8 germline light chain variable domain
Species: Homo sapiens [TaxId:9606]
Gene: Vk1 O18/O8 light chain germline
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2q20a_ - Chain 'B':
Compound: Vk1 O18/O8 germline light chain variable domain
Species: Homo sapiens [TaxId:9606]
Gene: Vk1 O18/O8 light chain germline
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2q20b_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2q20A (A:)
stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyycqqydnlpytfgqgtkleik
Sequence, based on observed residues (ATOM records): (download)
>2q20A (A:)
tdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvp
srfsgsgsgtdftftisslqpediatyycqqydnlpytfgqgtkleik
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2q20B (B:)
stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyycqqydnlpytfgqgtkleik