PDB entry 2q20

View 2q20 on RCSB PDB site
Description: Structure of the germline Vk1 O18/O8 light chain variable domain homodimer
Class: protein fibril
Keywords: Vk1, germline, AL, light chain amyloidosis, amyloid, immunoglobulin, light chain, light chain variable domain, PROTEIN FIBRIL
Deposited on 2007-05-25, released 2008-04-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.12
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vk1 O18/O8 germline light chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Gene: Vk1 O18/O8 light chain germline
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2q20a_
  • Chain 'B':
    Compound: Vk1 O18/O8 germline light chain variable domain
    Species: Homo sapiens [TaxId:9606]
    Gene: Vk1 O18/O8 light chain germline
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2q20b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q20A (A:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqydnlpytfgqgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q20A (A:)
    tdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvp
    srfsgsgsgtdftftisslqpediatyycqqydnlpytfgqgtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q20B (B:)
    stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv
    psrfsgsgsgtdftftisslqpediatyycqqydnlpytfgqgtkleik