PDB entry 2q1e
View 2q1e on RCSB PDB site
Description: Altered dimer interface decreases stability in an amyloidogenic kappa1 Bence Jones protein.
Class: protein fibril
Keywords: AL, light chain amyloidosis, amyloid, immunoglobulin, light chain, light chain variable domain, PROTEIN FIBRIL
Deposited on
2007-05-24, released
2008-04-08
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.166
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Amyloidogenic immunoglobulin light chain protein AL-09
Species: Homo sapiens [TaxId:9606]
Gene: mutant of Vk1 O18/O8 germline
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2q1ea_ - Chain 'B':
Compound: Amyloidogenic immunoglobulin light chain protein AL-09
Species: Homo sapiens [TaxId:9606]
Gene: mutant of Vk1 O18/O8 germline
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2q1eb_ - Chain 'C':
Compound: Amyloidogenic immunoglobulin light chain protein AL-09
Species: Homo sapiens [TaxId:9606]
Gene: mutant of Vk1 O18/O8 germline
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2q1ec_ - Chain 'D':
Compound: Amyloidogenic immunoglobulin light chain protein AL-09
Species: Homo sapiens [TaxId:9606]
Gene: mutant of Vk1 O18/O8 germline
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2q1ed_ - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2q1eA (A:)
atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2q1eB (B:)
atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2q1eC (C:)
atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2q1eD (D:)
atdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
psrfsgsgsgteftftisslqpedlatyhcqqydnlpytfgqgtkleik