PDB entry 2q13

View 2q13 on RCSB PDB site
Description: Crystal structure of BAR-PH domain of APPL1
Class: protein transport
Keywords: APPL1, BAR domain, PH domain, BAR-PH domain, PROTEIN TRANSPORT
Deposited on 2007-05-23, released 2007-08-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.208
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DCC-interacting protein 13 alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: APPL1, APPL, DIP13A, KIAA1428
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKG1 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.04: d2q13a1, d2q13a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q13A (A:)
    gshmdklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathl
    tskllkeyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfke
    rdlkeiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmh
    yfcalntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrrem
    dsdietmqqtiedlevasdplyvpdpdptkfpvnrnltrkagylnarnktglvsstwdrq
    fyftqggnlmsqargdvagglamdidncsvmavdcedrrycfqitsfdgkkssilqaesk
    kdheewictinniskqiylsenpee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q13A (A:)
    mdklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltsk
    llkeyekqrfpldevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkei
    ltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcaln
    tlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdiet
    mqqtiedlevasdplyvpdpdptkfpvnrnltrkagylnartwdrqfyftqggnlmsqar
    gdvagglamdidncsvmavdcedrrycfqitsfdgkkssilqaeskkdheewictinnis
    kqiy