PDB entry 2pzy

View 2pzy on RCSB PDB site
Description: Structure of MK2 Complexed with Compound 76
Class: transferase
Keywords: MK2, Protein Kinase, TRANSFERASE
Deposited on 2007-05-18, released 2007-07-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.251
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pzya_
  • Chain 'B':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pzyb_
  • Chain 'C':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pzyc_
  • Chain 'D':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pzyd_
  • Heterogens: B18, STU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pzyA (A:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzyA (A:)
    qfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpka
    rrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdraftereas
    eimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevl
    gpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevs
    eevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pzyB (B:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzyB (B:)
    pqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarr
    evelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterea
    seimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapev
    lgpekydkscdmwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmli
    rnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pzyC (C:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzyC (C:)
    qfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpka
    rrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafter
    easeimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvap
    evlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpews
    evseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedv
    keemtsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pzyD (D:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsl
    ttpcytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrir
    mgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsr
    vlkedkerwedvkeemtsalatmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pzyD (D:)
    fpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkar
    revelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettcytpyyvapev
    lgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsev
    seevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvl