PDB entry 2pyo

View 2pyo on RCSB PDB site
Description: Drosophila nucleosome core
Class: Structural protein/DNA
Keywords: Nucleosome core, histone fold, Structural protein/DNA COMPLEX
Deposited on 2007-05-16, released 2007-11-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pyoa_
  • Chain 'B':
    Compound: histone h4
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His4, H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pyob1
  • Chain 'C':
    Compound: histone h2a
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His2A, H2a
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: histone h2b
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His2B
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: histone h3
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pyoe_
  • Chain 'F':
    Compound: histone h4
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His4, H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pyof1
  • Chain 'G':
    Compound: histone h2a
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His2A, H2a
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: histone h2b
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: His2B
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: DNA (147-mer)
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: DNA (147-mer)
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pyoA (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pyoA (A:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pyoB (B:)
    tgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pyoB (B:)
    rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
    amdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pyoE (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pyoE (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pyoF (F:)
    tgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pyoF (F:)
    akrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyte
    hakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.