PDB entry 2pxz

View 2pxz on RCSB PDB site
Description: E. coli phosphoenolpyruvate carboxykinase (PEPCK) complexed with ATP, Mg2+, Mn2+, carbon dioxide and oxaloacetate
Class: lyase
Keywords: p-loop, oxaloacetate, carbon dioxide, CO2, LYASE
Deposited on 2007-05-14, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Escherichia coli [TaxId:83333]
    Gene: pckA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pxzx1, d2pxzx2
  • Heterogens: MG, MN, OAA, ATP, CO2, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2pxzX (X:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pxzX (X:)
    pqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrspk
    dkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcgan
    pdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnse
    nfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdvavffg
    lsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynairrda
    llenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadafgvl
    ppvsrltadqtqyhflsgftaklageptptfsacfgaaflslhptqyaevlvkrmqaaga
    qaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptelpgvdtkil
    dprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl