PDB entry 2pxy

View 2pxy on RCSB PDB site
Description: Crystal structures of immune receptor complexes
Class: immune system
Keywords: complex, IMMUNE SYSTEM
Deposited on 2007-05-14, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.218
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pxya_
  • Chain 'B':
    Compound: T cell receptor beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pxyb_
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, A-U alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14438 (5-182)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2pxyc1, d2pxyc2, d2pxyc3
  • Chain 'D':
    Compound: H-2 class II histocompatibility antigen, A-U beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pxyd1, d2pxyd2
  • Chain 'P':
    Compound: Myelin basic protein (MBP)-peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2PXY (Start-12)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pxyA (A:)
    sadsvtqtggqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgss
    rgfeatynkeatsfhlqkasvqesdsavyycalsenygnekitfgagtklqvvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pxyB (B:)
    avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghglrliyysygagstekgdipd
    gykasrpsqenfsltlesatpsqtsvyfcasgdasgaetlyfgpgtrltvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pxyC (C:)
    ddieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpq
    gglqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvi
    nitwlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkh
    wep
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pxyD (D:)
    dserhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyy
    nkqylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtdf
    ypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslks
    pitvewraq
    

  • Chain 'P':
    No sequence available.