PDB entry 2pxw

View 2pxw on RCSB PDB site
Description: Crystal Structure of N66D Mutant of Green Fluorescent Protein from Zoanthus sp. at 2.4 A Resolution (Transition State)
Class: fluorescent protein
Keywords: Zoanthus family, red fluorescent protein, green fluorescent protein, chromophore structure, FLUORESCENT PROTEIN
Deposited on 2007-05-14, released 2007-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like fluorescent chromoprotein FP506
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y5 (0-230)
      • chromophore (62)
    Domains in SCOPe 2.08: d2pxwa_
  • Chain 'B':
    Compound: GFP-like fluorescent chromoprotein FP506
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y5 (0-230)
      • chromophore (62)
    Domains in SCOPe 2.08: d2pxwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pxwA (A:)
skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
afdygdygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm
yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq
fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pxwB (B:)
skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
afdygdygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencm
yheskfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcq
fdtvykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp