PDB entry 2pwz

View 2pwz on RCSB PDB site
Description: Crystal structure of the apo form of E.Coli malate dehydrogenase
Class: oxidoreductase
Keywords: apo form of e.coli malate dehydrogenase in space group c2, oxidoreductase
Deposited on 2007-05-14, released 2007-05-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pwza1, d2pwza2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pwzc1, d2pwzc2
  • Chain 'E':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pwze1, d2pwze2
  • Chain 'G':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pwzg1, d2pwzg2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwzA (A:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgeefvnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pwzC (C:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgeefvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwzC (C:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvardrsdlfnvnagivknlvqqvaktcpkacigiitnpvntt
    vaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgvtilp
    llsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvralqg
    eqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlkkdia
    lgeefvnk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwzE (E:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgeefvnk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwzG (G:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiirsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgeefvnk