PDB entry 2pww

View 2pww on RCSB PDB site
Description: Crystal structure of ABC2387 from Bacillus clausii
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2007-05-14, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacillus clausii [TaxId:66692]
    Gene: ABC2387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5WFD8 (3-End)
      • cloning artifact (1-2)
      • modified residue (40)
      • modified residue (75)
    Domains in SCOPe 2.08: d2pwwa1, d2pwwa2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2pwwA (A:)
mslkfpdtgleekevafsivnhaakslgfihvdqwdyervmfdykivhhegtfylrvpay
avkgeiprpstivqimtpilgkyyyphgveyegetfpqavidkcnnklallaktikaewe
ghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2pwwA (A:)
slkfpdtgleekevafsivnhaakslgfihvdqwdyervmfdykivhhegtfylrvpaya
vkgeiprpstivqimtpilgkyyyphgveyegetfpqavidkcnnklallaktik