PDB entry 2pwl

View 2pwl on RCSB PDB site
Description: Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic N549H Mutation Responsible for Crouzon Syndrome.
Class: transferase
Keywords: Kinase Domain Fold Consisting of N- and C-lobes, transferase
Deposited on 2007-05-11, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (46)
      • engineered (104)
    Domains in SCOPe 2.07: d2pwla_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (46)
      • engineered (104)
    Domains in SCOPe 2.07: d2pwlb_
  • Heterogens: SO4, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pwlA (A:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniihllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykkttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwlA (A:)
    elpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatek
    dlsdlvsememmkmigkhkniihllgactqdgplyviveyaskgnlreylrarrpeqmtf
    kdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykkt
    tngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkegh
    rmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pwlB (B:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniihllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyykkttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwlB (B:)
    lpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatekd
    lsdlvsememmkmigkhkniihllgactqdgplyviveyaskgnlreylrarrppgeqmt
    fkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykk
    ttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeg
    hrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltltt