PDB entry 2pwd

View 2pwd on RCSB PDB site
Description: Crystal Structure of the Trehalulose Synthase MUTB from Pseudomonas Mesoacidophila MX-45 Complexed to the Inhibitor Deoxynojirmycin
Class: Isomerase
Keywords: TREHALULOSE SYNTHASE, SUCROSE ISOMERASE, ALPHA-AMYLASE FAMILY, (BETA/ALPHA)8 BARREL, Isomerase
Deposited on 2007-05-11, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pwda1, d2pwda2
  • Chain 'B':
    Compound: Sucrose isomerase
    Species: Pseudomonas mesoacidophila [TaxId:265293]
    Gene: mutB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pwdb1, d2pwdb2
  • Heterogens: CA, NOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwdA (A:)
    kpgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspnt
    dngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskd
    npyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklre
    elyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemh
    ekvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtla
    dfrqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgt
    pfifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartp
    fqwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgs
    yrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaag
    aaslelqpwqsgiykvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pwdB (B:)
    kpgapwwksavfyqvyprsfkdtngdgigdfkgltekldylkglgidaiwinphyaspnt
    dngydisdyrevmkeygtmedfdrlmaelkkrgmrlmvdvvinhssdqhewfkssraskd
    npyrdyyfwrdgkdghepnnypsffggsawekdpvtgqyylhyfgrqqpdlnwdtpklre
    elyamlrfwldkgvsgmrfdtvatysktpgfpdltpeqmknfaeaytqgpnlhrylqemh
    ekvfdhydavtageifgaplnqvplfidsrrkeldmaftfdlirydraldrwhtiprtla
    dfrqtidkvdaiageygwntfflgnhdnpravshfgddrpqwreasakalatvtltqrgt
    pfifqgdelgmtnypfktlqdfddievkgffqdyvetgkataeelltnvaltsrdnartp
    fqwddsanagfttgkpwlkvnpnyteinaareigdpksvysfyrnlisirhetpalstgs
    yrdidpsnadvyaytrsqdgetylvvvnfkaeprsftlpdgmhiaetliessspaapaag
    aaslelqpwqsgiykvk