PDB entry 2pw5

View 2pw5 on RCSB PDB site
Description: Crystal Structure of Staphylococcal nuclease variant V66Y/P117G/H124L/S128A at room temperature
Class: hydrolase
Keywords: Staphyloccal nuclease, nuclease, hyperstable variant, internal waters, hydrolase
Deposited on 2007-05-10, released 2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI6
      • engineered (65)
      • engineered (116)
      • engineered (127)
    Domains in SCOPe 2.08: d2pw5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2pw5A (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmyenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
heqllrkaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >2pw5A (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkvekygpeasaftkkmyenakk
ievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaq
akkeklniws