PDB entry 2pvy

View 2pvy on RCSB PDB site
Description: Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic K659N Mutation Responsible for an Unclassified Craniosynostosis Syndrome.
Class: transferase
Keywords: Kinase Domain Fold Consisting of N- and C-lobes, transferase
Deposited on 2007-05-10, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (214)
    Domains in SCOPe 2.07: d2pvya_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pvyb_
  • Chain 'C':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pvyc_
  • Chain 'D':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • engineered (214)
    Domains in SCOPe 2.07: d2pvyd_
  • Heterogens: SO4, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pvyA (A:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyyknttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvyA (A:)
    elpedpkwefprdkltlgkplqvvmaeavgidkdkpkeavtvavkmlkddatekdlsdlv
    sememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmdinrvpee
    qmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidy
    yknttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkll
    keghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pvyB (B:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyyknttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvyB (B:)
    gvseyelpedpkwefprdkltlgkplqvvmaeavgidkdkpkeavtvavkmlkddatekd
    lsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgdinr
    vpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardin
    nyykgrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllke
    ghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pvyC (C:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyyknttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvyC (C:)
    gvseyelpedpkwefprdkltlgkplqvvmaeavgidkdkpkeavtvavkmlkddatekd
    lsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmevp
    eeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinny
    ykngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeg
    hrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pvyD (D:)
    mgsshhhhhhsqdpmlagvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgid
    kdkpkeavtvavkmlkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviv
    eyaskgnlreylrarrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcih
    rdlaarnvlvtennvmkiadfglardinnidyyknttngrlpvkwmapealfdrvythqs
    dvwsfgvlmweiftlggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavp
    sqrptfkqlvedldriltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvyD (D:)
    elpedpkwefprdkltlgkplqvvmaeavgidkdkpkeavtvavkmlkddatekdlsdlv
    sememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgvpeeqmtfk
    dlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykntt
    ngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeghr
    mdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt