PDB entry 2pvx

View 2pvx on RCSB PDB site
Description: NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of Rubredoxin
Class: electron transport
Keywords: rubredoxin, chimeric, Pyrococcus furiosus, ELECTRON TRANSPORT
Deposited on 2007-05-10, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.139
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297
      • engineered (1)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvxa_
  • Chain 'B':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297
      • engineered (1)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvxb_
  • Chain 'C':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297
      • engineered (1)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvxc_
  • Chain 'D':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297
      • engineered (1)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvxd_
  • Chain 'E':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297
      • engineered (1)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvxe_
  • Chain 'F':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297
      • engineered (1)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvxf_
  • Chain 'G':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297
      • engineered (1)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvxg_
  • Chain 'H':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297 (0-53)
      • engineered (1)
      • engineered (6-7)
      • engineered (40)
      • engineered (43-44)
      • engineered (46-47)
    Domains in SCOPe 2.07: d2pvxh_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pvxA (A:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvxA (A:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvxB (B:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvxC (C:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvxD (D:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvxE (E:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvxF (F:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvxG (G:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvxH (H:)
    mkkwvctvcgyiydedagdpdngispgtkfeelpddwvcplcgvgkdqfekled