PDB entry 2pvw

View 2pvw on RCSB PDB site
Description: A high resolution structure of human glutamate carboxypeptidase II (GCPII) in complex with 2-(phosphonomethyl)pentanedioic acid (2-PMPA)
Class: Hydrolase
Keywords: prostate specific membrane antigen; metallopeptidase; folate hydrolase; glutamate carboxypeptidase II; Naaladase; 2-(phosphonomethyl)pentanedioic acid; 2-(PMPA), Hydrolase
Deposited on 2007-05-10, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.183
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pvwa1, d2pvwa2, d2pvwa3
  • Heterogens: NAG, ZN, CA, CL, G88, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pvwA (A:)
    rskssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwk
    efgldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppf
    safspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlag
    akgvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrr
    giaeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqk
    vkmhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrs
    fgtlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnyt
    lrvdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndf
    evffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrg
    gmvfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfte
    iaskfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkya
    gesfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvwA (A:)
    hnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydv
    llsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlv
    yvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyf
    apgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvh
    pigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtri
    ynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrt
    ilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvh
    nltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgra
    rytknnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfdcr
    dyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfsnpiv
    lrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdieskvd
    pskawgevkrqiyvaaftvqaaaetlseva