PDB entry 2pvv

View 2pvv on RCSB PDB site
Description: Structure of human glutamate carboxypeptidase II (GCPII) in complex with L-serine-O-sulfate
Class: Hydrolase
Keywords: prostate specific membrane antigen; metallopeptidase; folate hydrolase; glutamate carboxypeptidase II; Naaladase; L-serine-O-sulfate; L-SOS, Hydrolase
Deposited on 2007-05-10, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOLH1, FOLH, NAALAD1, PSM, PSMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pvva1, d2pvva2, d2pvva3
  • Heterogens: NAG, ZN, CA, CL, OSE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pvvA (A:)
    rskssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwk
    efgldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppf
    safspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlag
    akgvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrr
    giaeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqk
    vkmhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrs
    fgtlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnyt
    lrvdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndf
    evffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrg
    gmvfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfte
    iaskfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkya
    gesfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvvA (A:)
    khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
    vllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdl
    vyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpady
    fapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipv
    hpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstnevtr
    iynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprr
    tilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslv
    hnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgr
    arytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlp
    fdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfs
    npivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdie
    skvdpskawgevkrqiyvaaftvqaaaetlseva