PDB entry 2pvr

View 2pvr on RCSB PDB site
Description: Crystal structure of the catalytic subunit of protein kinase CK2 (C-terminal deletion mutant 1-335) in complex with two sulfate ions
Class: signaling protein, transferase
Keywords: EUKARYOTIC PROTEIN KINASE FOLD, CMGC kinases
Deposited on 2007-05-10, released 2007-06-26
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-26, with a file datestamp of 2007-06-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha, catalytic subunit
    Species: HOMO SAPIENS
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pvra1
  • Heterogens: SO4, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pvrA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pvrA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvk