PDB entry 2pvq

View 2pvq on RCSB PDB site
Description: Crystal structure of Ochrobactrum anthropi glutathione transferase Cys10Ala mutant with glutathione bound at the H-site
Class: transferase
Keywords: xenobiotics detoxification, glutathione, H-site, TRANSFERASE
Deposited on 2007-05-10, released 2008-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glutathione s-transferase
  Species: Ochrobactrum anthropi [TaxId:529]
  Gene: GST
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81065 (0-200)
    • engineered (9)
  Domains in SCOPe 2.05: d2pvqa1, d2pvqa2
• Heterogens: SO4, GSH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pvqA (A:)
  mklyykvgaaslaphiilseaglpyeleavdlkakktadggdyfavnprgavpalevkpg
  tvitqnaailqyigdhsdvaafkpaygsierarlqealgfcsdlhaafsglfapnlseea
  ragvianinrrlgqleamlsdknaywlgddftqpdayasviigwgvgqkldlsaypkalk
  lrervlarpnvqkafkeegln