PDB entry 2pvb

View 2pvb on RCSB PDB site
Description: pike parvalbumin (pi 4.10) at low temperature (100k) and atomic resolution (0.91 a).
Deposited on 1998-10-02, released 1998-10-07
The last revision prior to the SCOP 1.59 freeze date was dated 2000-05-05, with a file datestamp of 2000-05-05.
Experiment type: XRAY
Resolution: 0.91 Å
R-factor: 0.1098
AEROSPACI score: 1.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d2pvba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvbA (A:)
    sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
    elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika