PDB entry 2pua

View 2pua on RCSB PDB site
Description: crystal structure of the laci family member, purr, bound to DNA: minor groove binding by alpha helices
Class: transcription/DNA
Keywords: complex (DNA-binding protein/DNA), DNA-binding regulatory protein
Deposited on 1997-10-04, released 1998-05-06
The last revision prior to the SCOP 1.73 freeze date was dated 1998-05-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.166
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine repressor
    Species: ESCHERICHIA COLI
    Gene: PURR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACP7 (0-End)
      • engineered (188)
    Domains in SCOP 1.73: d2puaa1, d2puaa2
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*ap*ap*ap*cp*gp*tp*tp*tp*gp*cp*gp*t )-3')
  • Heterogens: 6MP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2puaA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2puaA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyr
    

  • Chain 'B':
    No sequence available.