PDB entry 2pu2

View 2pu2 on RCSB PDB site
Description: AmpC beta-lactamase with bound Phthalamide inhibitor
Class: hydrolase
Keywords: AmpC beta-lacamase phthalamide, HYDROLASE
Deposited on 2007-05-08, released 2008-04-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.179
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: ampC, ampA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pu2a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: ampC, ampA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pu2b_
  • Heterogens: PO4, DK2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pu2A (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pu2B (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq