PDB entry 2ptk

View 2ptk on RCSB PDB site
Description: chicken src tyrosine kinase
Class: tyrosine-protein kinase
Keywords: tyrosine-protein kinase, src, sh2, sh3
Deposited on 1997-06-17, released 1997-12-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase transforming protein Src
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523
      • modified residue (446)
    Domains in SCOPe 2.03: d2ptka1, d2ptka2, d2ptka3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ptkA (A:)
    ggvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
    dsiqaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvk
    hykirkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskpqtqglakdaw
    eipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgnmspeaflqeaqvmkklrhe
    klvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayverm
    nyvhrdlraanilvgenlvckvadfglgrliedneytarqgakfpikwtapeaalygrft
    iksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwr
    kdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ptkA (A:)
    vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsds
    iqaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhy
    kirkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskpqtqglakdawei
    preslrlevklgqgcfgevwmgtwngttrvaiktlkppeaflqeaqvmkklrheklvqly
    avvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrd
    lraanilvgenlvckvadfglfpikwtapeaalygrftiksdvwsfgilltelttkgrvp
    ypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyfts
    tepqyq