PDB entry 2ptk

View 2ptk on RCSB PDB site
Description: chicken src tyrosine kinase
Deposited on 1997-06-17, released 1997-12-24
The last revision prior to the SCOP 1.59 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.204
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2ptk_ (-)
    vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsds
    iqaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhy
    kirkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskpqtqglakdawei
    preslrlevklgqgcfgevwmgtwngttrvaiktlkpgnmspeaflqeaqvmkklrhekl
    vqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermny
    vhrdlraanilvgenlvckvadfglgrliedneytarqgakfpikwtapeaalygrftik
    sdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkd
    peerptfeylqafledyftstepqyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ptk_ (-)
    vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsds
    iqaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhy
    kirkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskpqtqglakdawei
    preslrlevklgqgcfgevwmgtwngttrvaiktlkppeaflqeaqvmkklrheklvqly
    avvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrd
    lraanilvgenlvckvadfglfpikwtapeaalygrftiksdvwsfgilltelttkgrvp
    ypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyfts
    tepqyq