PDB entry 2pth

View 2pth on RCSB PDB site
Description: peptidyl-tRNA hydrolase from escherichia coli
Class: hydrolase
Keywords: hydrolase, peptidyl-tRNA
Deposited on 1997-03-25, released 1998-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.196
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Escherichia coli [TaxId:83333]
    Gene: PTH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ptha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pthA (A:)
tiklivglanpgaeyaatrhnagawfvdllaerlraplreeakffgytsrvtlggedvrl
lvpttfmnlsgkavaamasffrinpdeilvahdeldlppgvakfklggghgghnglkdii
sklgnnpnfhrlrigighpgdknkvvgfvlgkppvseqklideaideaarctemwftdgl
tkatnrlhafkaq