PDB entry 2psq

View 2psq on RCSB PDB site
Description: Crystal Structure of Unphosphorylated Unactivated Wild Type FGF Receptor 2 (FGFR2) Kinase Domain
Class: transferase
Keywords: Kinase Domain Fold Consisting of N- and C-lobes, TRANSFERASE
Deposited on 2007-05-07, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psqa_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psqb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2psqA (A:)
    mgsshhhhhhsqdppavhkltkriplrrqvtvsaessssmnsntplvrittrlsstadtp
    mlagvseyelpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkm
    lkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylra
    rrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtenn
    vmkiadfglardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweift
    lggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedld
    riltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psqA (A:)
    lpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatekd
    lsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrpppeeqm
    tfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyyk
    kttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllke
    ghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltltt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2psqB (B:)
    mgsshhhhhhsqdppavhkltkriplrrqvtvsaessssmnsntplvrittrlsstadtp
    mlagvseyelpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkm
    lkddatekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylra
    rrppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtenn
    vmkiadfglardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweift
    lggspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedld
    riltlttnee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psqB (B:)
    elpedpkwefprdkltlgkplgegcfgqvvmaeavgidpkeavtvavkmlkddatekdls
    dlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgeeqmtf
    kdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykkt
    tngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkegh
    rmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlttn