PDB entry 2psn

View 2psn on RCSB PDB site
Description: Crystal structure of enolase1
Class: lyase
Keywords: Enolase1, LYASE
Deposited on 2007-05-07, released 2008-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-enolase
    Species: HOMO SAPIENS
    Gene: ENO1, ENO1L1, MBPB1, MPB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psna1, d2psna2
  • Chain 'B':
    Compound: Alpha-enolase
    Species: HOMO SAPIENS
    Gene: ENO1, ENO1L1, MBPB1, MPB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psnb1, d2psnb2
  • Chain 'C':
    Compound: Alpha-enolase
    Species: HOMO SAPIENS
    Gene: ENO1, ENO1L1, MBPB1, MPB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psnc1, d2psnc2
  • Chain 'D':
    Compound: Alpha-enolase
    Species: HOMO SAPIENS
    Gene: ENO1, ENO1L1, MBPB1, MPB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psnd1, d2psnd2
  • Heterogens: MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2psnA (A:)
    msilkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgk
    gvskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavck
    agavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfre
    amrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkv
    vigmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqdd
    wgawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqackla
    qangwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgsk
    akfagrnfrnplak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psnA (A:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnpla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2psnB (B:)
    msilkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgk
    gvskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavck
    agavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfre
    amrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkv
    vigmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqdd
    wgawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqackla
    qangwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgsk
    akfagrnfrnplak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psnB (B:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnpla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2psnC (C:)
    msilkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgk
    gvskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavck
    agavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfre
    amrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkv
    vigmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqdd
    wgawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqackla
    qangwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgsk
    akfagrnfrnplak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psnC (C:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnplak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2psnD (D:)
    msilkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgk
    gvskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavck
    agavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfre
    amrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkv
    vigmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqdd
    wgawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqackla
    qangwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgsk
    akfagrnfrnplak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psnD (D:)
    silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
    vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
    gavekgvplyrhiadlagnsevilpvpafnvinggshagnklamqefmilpvgaanfrea
    mrigaevyhnlknvikekygkdatnvgdeggfapnilenkeglellktaigkagytdkvv
    igmdvaaseffrsgkydldfkspddpsryispdqladlyksfikdypvvsiedpfdqddw
    gawqkftasagiqvvgddltvtnpkriakavnekscnclllkvnqigsvteslqacklaq
    angwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqllrieeelgska
    kfagrnfrnpl