PDB entry 2psm

View 2psm on RCSB PDB site
Description: Crystal structure of Interleukin 15 in complex with Interleukin 15 receptor alpha
Class: cytokine
Keywords: Cytokine, Glycoprotein, Secreted, Alternative splicing, Endoplasmic reticulum, Golgi apparatus, Membrane, Nucleus, Phosphorylation, Receptor, Sushi, Transmembrane, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.224
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-15
    Species: Mus musculus [TaxId:10090]
    Gene: IL15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48346 (7-120)
      • expression tag (4-6)
    Domains in SCOPe 2.04: d2psma1
  • Chain 'B':
    Compound: Interleukin-15
    Species: Mus musculus [TaxId:10090]
    Gene: IL15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48346 (7-120)
      • expression tag (4-6)
    Domains in SCOPe 2.04: d2psmb_
  • Chain 'C':
    Compound: Interleukin-15 receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: IL15RA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2psmc1
  • Chain 'F':
    Compound: Interleukin-15 receptor alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: IL15RA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2psmf_
  • Heterogens: BAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2psmA (A:)
    gssgssgnwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilhe
    ysnmtlnetvrnvlylanstlssnknvaesgckeceeleektfteflqsfirivqmfint
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psmA (A:)
    ssgnwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilheysnm
    tlnetvrnvlylanstlssnknvaesgckeceeleektfteflqsfirivqmfints
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2psmB (B:)
    gssgssgnwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilhe
    ysnmtlnetvrnvlylanstlssnknvaesgckeceeleektfteflqsfirivqmfint
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psmB (B:)
    ssgnwidvrydlekiesliqsihidttlytdsdfhpsckvtamncfllelqvilheysnm
    tlnetvrnvlylanstlssnknvaesgckeceeleektfteflqsfirivqmfints
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2psmC (C:)
    gssgssggttcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntn
    vahwttpslkcirdpsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psmC (C:)
    tcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntnvahwttpsl
    kcirdpsla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2psmF (F:)
    gssgssggttcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntn
    vahwttpslkcirdpsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psmF (F:)
    tcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntnvahwttpsl
    kcirdpsl