PDB entry 2ps3

View 2ps3 on RCSB PDB site
Description: Structure and metal binding properties of ZnuA, a periplasmic zinc transporter from Escherichia coli
Class: metal transport
Keywords: The protein consists of two domains with a typical (beta/alfa)4 fold, METAL TRANSPORT
Deposited on 2007-05-04, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High-affinity zinc uptake system protein znuA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ps3a_
  • Chain 'B':
    Compound: High-affinity zinc uptake system protein znuA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ps3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ps3A (A:)
    avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
    afmqkpvsklpgakqvtiaqledvkpllmksihgddddhdhaeksdedhhhgdfnmhlwl
    speiaratavaihgklvelmpqsrakldanlkdfeaqlastetqvgnelaplkgkgyfvf
    hdaygyfekqfgltplghftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavves
    vargtsvrmgtldplgtniklgktsyseflsqlanqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ps3A (A:)
    avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
    afmqkpvsklpgakqvtiaqledvkpllmkshgdfnmhlwlspeiaratavaihgklvel
    mpqsrakldanlkdfeaqlastetqvgnelaplkgkgyfvfhdaygyfekqfgltplghf
    tvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavvesvargtsvrmgtldplgtni
    klgktsyseflsqlanqyasclkgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ps3B (B:)
    avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
    afmqkpvsklpgakqvtiaqledvkpllmksihgddddhdhaeksdedhhhgdfnmhlwl
    speiaratavaihgklvelmpqsrakldanlkdfeaqlastetqvgnelaplkgkgyfvf
    hdaygyfekqfgltplghftvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavves
    vargtsvrmgtldplgtniklgktsyseflsqlanqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ps3B (B:)
    avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
    afmqkpvsklpgakqvtiaqledvkpllmksgdfnmhlwlspeiaratavaihgklvelm
    pqsrakldanlkdfeaqlastetqvgnelaplkgkgyfvfhdaygyfekqfgltplghft
    vnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavvesvargtsvrmgtldplgtnik
    lgktsyseflsqlanqyasclkgd