PDB entry 2ps2

View 2ps2 on RCSB PDB site
Description: Crystal structure of putative mandelate racemase/muconate lactonizing enzyme from Aspergillus oryzae
Class: structural genomics, unknown function
Keywords: Structural Genomics, NYSGXRC, target 9440a, enolase superfamily, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2007-05-04, released 2007-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Aspergillus oryzae [TaxId:510516]
    Gene: AO090011000058
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ps2a1, d2ps2a2
  • Chain 'B':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Aspergillus oryzae [TaxId:510516]
    Gene: AO090011000058
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ps2b1, d2ps2b2
  • Chain 'C':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Aspergillus oryzae [TaxId:510516]
    Gene: AO090011000058
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ps2c1, d2ps2c2
  • Chain 'D':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Aspergillus oryzae [TaxId:510516]
    Gene: AO090011000058
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ps2d1, d2ps2d2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ps2A (A:)
    msdlkiaridvfqvdlpysggvyylsagreyrsfdativrittdtgiegwgestpfgsny
    iashprgvragiatmapsligldprrvdrindamddallghedaktaidvacwdifgksv
    glpvcellggrtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakri
    taalanqqpdeffivdangklsvetalrllrllphgldfaleapcatwrecislrrktdi
    piiydelatnemsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcg
    sdiafaaivhlaqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprl
    dvlgeavasyf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ps2A (A:)
    dlkiaridvfqvdlpysggvyylsfdativrittdtgiegwgestpfgsnyiashprgvr
    agiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvglpvcellg
    grtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakritaalanqqp
    deffivdangklsvetalrllrllphgldfaleapcatwrecislrrktdipiiydelat
    nemsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcgsdiafaaiv
    hlaqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprldvlgeavas
    y
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ps2B (B:)
    msdlkiaridvfqvdlpysggvyylsagreyrsfdativrittdtgiegwgestpfgsny
    iashprgvragiatmapsligldprrvdrindamddallghedaktaidvacwdifgksv
    glpvcellggrtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakri
    taalanqqpdeffivdangklsvetalrllrllphgldfaleapcatwrecislrrktdi
    piiydelatnemsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcg
    sdiafaaivhlaqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprl
    dvlgeavasyf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ps2B (B:)
    dlkiaridvfqvdlpysggvyylsfdativrittdtgiegwgestpfgsnyiashprgvr
    agiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvglpvcellg
    grtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakritaalanqqp
    deffivdangklsvetalrllrllphgldfaleapcatwrecislrrktdipiiydelat
    nemsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcgsdiafaaiv
    hlaqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprldvlgeavas
    y
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ps2C (C:)
    msdlkiaridvfqvdlpysggvyylsagreyrsfdativrittdtgiegwgestpfgsny
    iashprgvragiatmapsligldprrvdrindamddallghedaktaidvacwdifgksv
    glpvcellggrtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakri
    taalanqqpdeffivdangklsvetalrllrllphgldfaleapcatwrecislrrktdi
    piiydelatnemsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcg
    sdiafaaivhlaqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprl
    dvlgeavasyf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ps2C (C:)
    dlkiaridvfqvdlpysggvyylsfdativrittdtgiegwgestpfgsnyiashprgvr
    agiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvglpvcellg
    grtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakritaalanqqp
    deffivdangklsvetalrllrllphgldfaleapcatwrecislrrktdipiiydelat
    nemsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcgsdiafaaiv
    hlaqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprldvlgeavas
    y
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ps2D (D:)
    msdlkiaridvfqvdlpysggvyylsagreyrsfdativrittdtgiegwgestpfgsny
    iashprgvragiatmapsligldprrvdrindamddallghedaktaidvacwdifgksv
    glpvcellggrtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakri
    taalanqqpdeffivdangklsvetalrllrllphgldfaleapcatwrecislrrktdi
    piiydelatnemsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcg
    sdiafaaivhlaqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprl
    dvlgeavasyf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ps2D (D:)
    dlkiaridvfqvdlpysggvyylsfdativrittdtgiegwgestpfgsnyiashprgvr
    agiatmapsligldprrvdrindamddallghedaktaidvacwdifgksvglpvcellg
    grtntrlplissiyvgepedmrarvakyrakgykgqsvkisgepvtdakritaalanqqp
    deffivdangklsvetalrllrllphgldfaleapcatwrecislrrktdipiiydelat
    nemsivkiladdaaegidlkiskaggltrgrrqrdiclaagysvsvqetcgsdiafaaiv
    hlaqtiperslrcilecrdmvtvktadgafdiqdgfatapttpglgimprldvlgeavas
    y