PDB entry 2pro

View 2pro on RCSB PDB site
Description: pro region of alpha-lytic protease
Deposited on 1998-08-20, released 1999-04-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.202
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2proA (A:)
    dpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklv
    aatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswyvdpr
    snavvvkvddgatdagvdfvalsgadsaqvries
    

    Sequence, based on observed residues (ATOM records): (download)
    >2proA (A:)
    dpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklv
    aatsgarksstlggvevrnvryslkqlqsameqldagagvqswyvdprsnavvvkvddga
    tdagvdfvalsgadsaqvries
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2proB (B:)
    vdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfkl
    vaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswyvdp
    rsnavvvkvddgatdagvdfvalsgadsaqvries
    

    Sequence, based on observed residues (ATOM records): (download)
    >2proB (B:)
    vdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfkl
    vaatsgarksstlggvevrnvryslkqlqsameqldagagvqswyvdprsnavvvkvddg
    atdagvdfvalsgadsaqvries
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2proC (C:)
    ifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklvaatsgarksstlg
    gvevrnvryslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgat
    dagvdfvalsgadsaqvries
    

    Sequence, based on observed residues (ATOM records): (download)
    >2proC (C:)
    ifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklvaatsgarksstlg
    gvevrnvryslkqlqsameqldagagvqswyvdprsnavvvkvddgatdagvdfvalsga
    dsaqvries