PDB entry 2pro

View 2pro on RCSB PDB site
Description: pro region of alpha-lytic protease
Class: pro region
Keywords: pro region, foldase, protein folding, serine protease
Deposited on 1998-08-20, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.202
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2proa1, d2proa2
  • Chain 'B':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2prob1, d2prob2
  • Chain 'C':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2proc1, d2proc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2proA (A:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2proA (A:)
    dpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklv
    aatsgarksstlggvevrnvryslkqlqsameqldagagvqswyvdprsnavvvkvddga
    tdagvdfvalsgadsaqvries
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2proB (B:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2proB (B:)
    vdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfkl
    vaatsgarksstlggvevrnvryslkqlqsameqldagagvqswyvdprsnavvvkvddg
    atdagvdfvalsgadsaqvries
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2proC (C:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2proC (C:)
    ifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklvaatsgarksstlg
    gvevrnvryslkqlqsameqldagagvqswyvdprsnavvvkvddgatdagvdfvalsga
    dsaqvries