PDB entry 2prg

View 2prg on RCSB PDB site
Description: ligand-binding domain of the human peroxisome proliferator activated receptor gamma
Class: complex (thiazolidinedione/receptor)
Keywords: complex (thiazolidinedione/receptor), ligand-binding domain, nuclear receptor, apo, transcription factor, orphan receptor
Deposited on 1998-08-14, released 1999-07-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN PPAR GAMMA CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2prga_
  • Chain 'B':
    Compound: Peroxisome proliferator activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN PPAR GAMMA CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2prgb_
  • Chain 'C':
    Compound: nuclear receptor coactivator src-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC-1 CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2prgc_
  • Heterogens: BRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2prgA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2prgB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prgB (B:)
    esadlralakhlydsyiksfpltkakarailtviydmnslmqskevairifqgcqfrsve
    avqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtre
    flkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqd
    nllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqe
    iykdly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2prgC (C:)
    dskysqtshklvqlltttaeqqlrhadidtsckdvlsctgtsnsasanssggscpsshss
    lterhkilhrllqegspsdittlsvepd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prgC (C:)
    qtshklvqllttterhkilhrllqegspsdit