PDB entry 2prg

View 2prg on RCSB PDB site
Description: ligand-binding domain of the human peroxisome proliferator activated receptor gamma
Deposited on 1998-08-14, released 1999-07-19
The last revision prior to the SCOP 1.61 freeze date was dated 1999-07-19, with a file datestamp of 1999-07-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d2prga_
  • Chain 'B':
    Domains in SCOP 1.61: d2prgb_
  • Chain 'C':
    Domains in SCOP 1.61: d2prgc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2prgA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2prgB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prgB (B:)
    esadlralakhlydsyiksfpltkakarailtviydmnslmqskevairifqgcqfrsve
    avqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtre
    flkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqd
    nllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqe
    iykdly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2prgC (C:)
    qtshklvqlltttaeqqlrhadidtsckdvlsctgtsnsasanssggscpsshsslterh
    kilhrllqegspsdit
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prgC (C:)
    qtshklvqllttterhkilhrllqegspsdit