PDB entry 2pr4

View 2pr4 on RCSB PDB site
Description: Crystal Structure of Fab' from the HIV-1 Neutralizing Antibody 2F5
Class: viral protein
Keywords: nmAb 2F5, gp41, HIV
Deposited on 2007-05-03, released 2007-05-15
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.24
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: nmAb 2F5 Fab' light Chain
    Species: HOMO SAPIENS
    Gene:
    Domains in SCOP 1.75: d2pr4h1, d2pr4h2
  • Chain 'L':
    Compound: nmAb 2F5 Fab' Heavy Chain
    Species: HOMO SAPIENS
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2pr4H (H:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
    vwgqgitvtisststkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
    gvhtfpavlqssglyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pr4H (H:)
    ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
    yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpgpvnamdvwgqgitvti
    sststkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtytcnvnhkpsntkvdkrvep
    

  • Chain 'L':
    No sequence available.